FXN monoclonal antibody (M05), clone 3E7 View larger

FXN monoclonal antibody (M05), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FXN monoclonal antibody (M05), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FXN monoclonal antibody (M05), clone 3E7

Brand: Abnova
Reference: H00002395-M05
Product name: FXN monoclonal antibody (M05), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant FXN.
Clone: 3E7
Isotype: IgG1 Kappa
Gene id: 2395
Gene name: FXN
Gene alias: CyaY|FA|FARR|FRDA|MGC57199|X25
Gene description: frataxin
Genbank accession: NM_000144
Immunogen: FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Protein accession: AAH48097.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002395-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002395-M05-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FXN is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FXN monoclonal antibody (M05), clone 3E7 now

Add to cart