Brand: | Abnova |
Reference: | H00002395-M03 |
Product name: | FXN monoclonal antibody (M03), clone 3G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FXN. |
Clone: | 3G9 |
Isotype: | IgG1 Kappa |
Gene id: | 2395 |
Gene name: | FXN |
Gene alias: | CyaY|FA|FARR|FRDA|MGC57199|X25 |
Gene description: | frataxin |
Genbank accession: | NM_000144 |
Immunogen: | FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL |
Protein accession: | AAH48097.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002395-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002395-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002395-M03-42-R01V-1.jpg](http://www.abnova.com/application_image/H00002395-M03-42-R01V-1.jpg) |
Application image note: | Western blot analysis of FXN over-expressed 293 cell line, cotransfected with FXN Validated Chimera RNAi ( Cat # H00002395-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FXN monoclonal antibody (M03), clone 3G9 (Cat # H00002395-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |