Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FXN monoclonal antibody (M02), clone 3F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about FXN monoclonal antibody (M02), clone 3F3
| Brand: | Abnova |
| Reference: | H00002395-M02 |
| Product name: | FXN monoclonal antibody (M02), clone 3F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FXN. |
| Clone: | 3F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2395 |
| Gene name: | FXN |
| Gene alias: | CyaY|FA|FARR|FRDA|MGC57199|X25 |
| Gene description: | frataxin |
| Genbank accession: | NM_000144 |
| Immunogen: | FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL |
| Protein accession: | AAH48097.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FXN is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Frataxin-deficient neurons and mice models of Friedreich ataxia are improved by TAT-MTScs-FXN treatment.Britti E, Delaspre F, Feldman A, Osborne M, Greif H, Tamarit J, Ros J. J Cell Mol Med. 2017 Oct 5. [Epub ahead of print] |