FXN MaxPab rabbit polyclonal antibody (D01) View larger

FXN MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FXN MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about FXN MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00002395-D01
Product name: FXN MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human FXN protein.
Gene id: 2395
Gene name: FXN
Gene alias: CyaY|FA|FARR|FRDA|MGC57199|X25
Gene description: frataxin
Genbank accession: NM_000144
Immunogen: FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Protein accession: AAH48097.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002395-D01-31-15-1.jpg
Application image note: Immunoprecipitation of FXN transfected lysate using anti-FXN MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FXN purified MaxPab mouse polyclonal antibody (B01P) (H00002395-B01P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy FXN MaxPab rabbit polyclonal antibody (D01) now

Add to cart