Brand: | Abnova |
Reference: | H00002358-M04 |
Product name: | FPR2 monoclonal antibody (M04), clone 2H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FPR2. |
Clone: | 2H7 |
Isotype: | IgG2a Kappa |
Gene id: | 2358 |
Gene name: | FPR2 |
Gene alias: | ALXR|FMLP-R-II|FMLPX|FPR2A|FPRH1|FPRH2|FPRL1|HM63|LXA4R |
Gene description: | formyl peptide receptor 2 |
Genbank accession: | BC029125 |
Immunogen: | FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR |
Protein accession: | AAH29125.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002358-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002358-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (30.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002358-M04-9-17-1.jpg](http://www.abnova.com/application_image/H00002358-M04-9-17-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged FPR2 is approximately 10ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |