Brand: | Abnova |
Reference: | H00002355-M02 |
Product name: | FOSL2 monoclonal antibody (M02), clone 4F5-1B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FOSL2. |
Clone: | 4F5-1B10 |
Isotype: | IgG2b Kappa |
Gene id: | 2355 |
Gene name: | FOSL2 |
Gene alias: | FLJ23306|FRA2 |
Gene description: | FOS-like antigen 2 |
Genbank accession: | BC008899 |
Immunogen: | FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC |
Protein accession: | AAH08899 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002355-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002355-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002355-M02-9-20-1.jpg](http://www.abnova.com/application_image/H00002355-M02-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged FOSL2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |