FOSL2 monoclonal antibody (M01), clone 2B4-1C2 View larger

FOSL2 monoclonal antibody (M01), clone 2B4-1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOSL2 monoclonal antibody (M01), clone 2B4-1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about FOSL2 monoclonal antibody (M01), clone 2B4-1C2

Brand: Abnova
Reference: H00002355-M01
Product name: FOSL2 monoclonal antibody (M01), clone 2B4-1C2
Product description: Mouse monoclonal antibody raised against a full length recombinant FOSL2.
Clone: 2B4-1C2
Isotype: IgG2b Kappa
Gene id: 2355
Gene name: FOSL2
Gene alias: FLJ23306|FRA2
Gene description: FOS-like antigen 2
Genbank accession: BC008899
Immunogen: FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC
Protein accession: AAH08899
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002355-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002355-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 20 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOSL2 monoclonal antibody (M01), clone 2B4-1C2 now

Add to cart