Brand: | Abnova |
Reference: | H00002355-M01 |
Product name: | FOSL2 monoclonal antibody (M01), clone 2B4-1C2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FOSL2. |
Clone: | 2B4-1C2 |
Isotype: | IgG2b Kappa |
Gene id: | 2355 |
Gene name: | FOSL2 |
Gene alias: | FLJ23306|FRA2 |
Gene description: | FOS-like antigen 2 |
Genbank accession: | BC008899 |
Immunogen: | FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC |
Protein accession: | AAH08899 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 20 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |