FOSL2 MaxPab mouse polyclonal antibody (B01) View larger

FOSL2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOSL2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about FOSL2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002355-B01
Product name: FOSL2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FOSL2 protein.
Gene id: 2355
Gene name: FOSL2
Gene alias: FLJ23306|FRA2
Gene description: FOS-like antigen 2
Genbank accession: NM_005253.3
Immunogen: FOSL2 (NP_005244.1, 1 a.a. ~ 326 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Protein accession: NP_005244.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002355-B01-13-15-1.jpg
Application image note: Western Blot analysis of FOSL2 expression in transfected 293T cell line (H00002355-T02) by FOSL2 MaxPab polyclonal antibody.

Lane 1: FOSL2 transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOSL2 MaxPab mouse polyclonal antibody (B01) now

Add to cart