Brand: | Abnova |
Reference: | H00002353-M63 |
Product name: | FOS monoclonal antibody (M63), clone 2C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOS. |
Clone: | 2C9 |
Isotype: | IgG2a Kappa |
Gene id: | 2353 |
Gene name: | FOS |
Gene alias: | AP-1|C-FOS |
Gene description: | v-fos FBJ murine osteosarcoma viral oncogene homolog |
Genbank accession: | NM_005252.2 |
Immunogen: | FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA |
Protein accession: | NP_005243.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |