FOS monoclonal antibody (M62), clone 4D5 View larger

FOS monoclonal antibody (M62), clone 4D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOS monoclonal antibody (M62), clone 4D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FOS monoclonal antibody (M62), clone 4D5

Brand: Abnova
Reference: H00002353-M62
Product name: FOS monoclonal antibody (M62), clone 4D5
Product description: Mouse monoclonal antibody raised against a partial recombinant FOS.
Clone: 4D5
Isotype: IgG2a Kappa
Gene id: 2353
Gene name: FOS
Gene alias: AP-1|C-FOS
Gene description: v-fos FBJ murine osteosarcoma viral oncogene homolog
Genbank accession: NM_005252.2
Immunogen: FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
Protein accession: NP_005243.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002353-M62-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOS monoclonal antibody (M62), clone 4D5 now

Add to cart