FOLR1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002348-D01P
Product name: FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FOLR1 protein.
Gene id: 2348
Gene name: FOLR1
Gene alias: FBP|FOLR|FR-alpha|MOv18
Gene description: folate receptor 1 (adult)
Genbank accession: NM_000802.2
Immunogen: FOLR1 (NP_000793.1, 1 a.a. ~ 257 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Protein accession: NP_000793.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002348-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FOLR1 expression in transfected 293T cell line (H00002348-T03) by FOLR1 MaxPab polyclonal antibody.

Lane 1: FOLR1 transfected lysate(29.80 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOLR1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart