AFF2 monoclonal antibody (M08), clone 4D11 View larger

AFF2 monoclonal antibody (M08), clone 4D11

H00002334-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AFF2 monoclonal antibody (M08), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about AFF2 monoclonal antibody (M08), clone 4D11

Brand: Abnova
Reference: H00002334-M08
Product name: AFF2 monoclonal antibody (M08), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant AFF2.
Clone: 4D11
Isotype: IgG2a Kappa
Gene id: 2334
Gene name: AFF2
Gene alias: FMR2|FRAXE|MRX2|OX19
Gene description: AF4/FMR2 family, member 2
Genbank accession: NM_002025
Immunogen: AFF2 (NP_002016.1, 109 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Protein accession: NP_002016.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002334-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002334-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged AFF2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AFF2 monoclonal antibody (M08), clone 4D11 now

Add to cart