Brand: | Abnova |
Reference: | H00002332-M03 |
Product name: | FMR1 monoclonal antibody (M03), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FMR1. |
Clone: | 3E11 |
Isotype: | IgG1 Kappa |
Gene id: | 2332 |
Gene name: | FMR1 |
Gene alias: | FMRP|FRAXA|MGC87458|POF|POF1 |
Gene description: | fragile X mental retardation 1 |
Genbank accession: | NM_002024 |
Immunogen: | FMR1 (NP_002015, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH |
Protein accession: | NP_002015 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002332-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002332-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002332-M03-9-22-1.jpg](http://www.abnova.com/application_image/H00002332-M03-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged FMR1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A quantitative homogeneous assay for fragile X mental retardation 1 protein.Schutzius G, Bleckmann D, Kapps-Fouthier S, di Giorgio F, Gerhartz B, Weiss A J Neurodev Disord. 2013 Apr 2;5(1):8. |