Brand: | Abnova |
Reference: | H00002332-A02 |
Product name: | FMR1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FMR1. |
Gene id: | 2332 |
Gene name: | FMR1 |
Gene alias: | FMRP|FRAXA|MGC87458|POF|POF1 |
Gene description: | fragile X mental retardation 1 |
Genbank accession: | NM_002024 |
Immunogen: | FMR1 (NP_002015, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH |
Protein accession: | NP_002015 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |