Brand: | Abnova |
Reference: | H00002324-M06 |
Product name: | FLT4 monoclonal antibody (M06), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLT4. |
Clone: | 2E3 |
Isotype: | IgG1 Kappa |
Gene id: | 2324 |
Gene name: | FLT4 |
Gene alias: | FLT41|LMPH1A|PCL|VEGFR3 |
Gene description: | fms-related tyrosine kinase 4 |
Genbank accession: | NM_002020 |
Immunogen: | FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR |
Protein accession: | NP_002011 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged FLT4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |