FLT4 monoclonal antibody (M02), clone 5F11 View larger

FLT4 monoclonal antibody (M02), clone 5F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLT4 monoclonal antibody (M02), clone 5F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FLT4 monoclonal antibody (M02), clone 5F11

Brand: Abnova
Reference: H00002324-M02
Product name: FLT4 monoclonal antibody (M02), clone 5F11
Product description: Mouse monoclonal antibody raised against a partial recombinant FLT4.
Clone: 5F11
Isotype: IgG2a Kappa
Gene id: 2324
Gene name: FLT4
Gene alias: FLT41|LMPH1A|PCL|VEGFR3
Gene description: fms-related tyrosine kinase 4
Genbank accession: NM_002020
Immunogen: FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Protein accession: NP_002011
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002324-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002324-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FLT4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLT4 monoclonal antibody (M02), clone 5F11 now

Add to cart