Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLT4 monoclonal antibody (M01), clone 5B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about FLT4 monoclonal antibody (M01), clone 5B6
| Brand: | Abnova |
| Reference: | H00002324-M01 |
| Product name: | FLT4 monoclonal antibody (M01), clone 5B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLT4. |
| Clone: | 5B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2324 |
| Gene name: | FLT4 |
| Gene alias: | FLT41|LMPH1A|PCL|VEGFR3 |
| Gene description: | fms-related tyrosine kinase 4 |
| Genbank accession: | NM_002020 |
| Immunogen: | FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR |
| Protein accession: | NP_002011 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FLT4 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Blood Plasma Biomarkers for Bevacizumab Combination Therapies for Treatment of Breast Cancer.Klause U, Moore N, Pallaud C, Scherer S, Wild N. United States Patent Application. 2015 Dec. 20150352204A1. |