H00002323-M07_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
Brand: | Abnova |
Reference: | H00002323-M07 |
Product name: | FLT3LG monoclonal antibody (M07), clone 4C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLT3LG. |
Clone: | 4C4 |
Isotype: | IgG2a Kappa |
Gene id: | 2323 |
Gene name: | FLT3LG |
Gene alias: | FL |
Gene description: | fms-related tyrosine kinase 3 ligand |
Genbank accession: | NM_001459 |
Immunogen: | FLT3LG (NP_001450, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE |
Protein accession: | NP_001450 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged FLT3LG is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |