FLT3LG purified MaxPab rabbit polyclonal antibody (D01P) View larger

FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

H00002323-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002323-D01P
Product name: FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FLT3LG protein.
Gene id: 2323
Gene name: FLT3LG
Gene alias: FL
Gene description: fms-related tyrosine kinase 3 ligand
Genbank accession: NM_001459
Immunogen: FLT3LG (NP_001450.2, 1 a.a. ~ 235 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Protein accession: NP_001450.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002323-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FLT3LG expression in transfected 293T cell line (H00002323-T01) by FLT3LG MaxPab polyclonal antibody.

Lane 1: FLT3LG transfected lysate(26.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLT3LG purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart