FLT3LG MaxPab mouse polyclonal antibody (B01) View larger

FLT3LG MaxPab mouse polyclonal antibody (B01)

H00002323-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLT3LG MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about FLT3LG MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002323-B01
Product name: FLT3LG MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FLT3LG protein.
Gene id: 2323
Gene name: FLT3LG
Gene alias: FL
Gene description: fms-related tyrosine kinase 3 ligand
Genbank accession: NM_001459
Immunogen: FLT3LG (NP_001450, 1 a.a. ~ 235 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Protein accession: NP_001450
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002323-B01-4-1-1-L.jpg
Application image note: Immunofluorescence of purified MaxPab antibody to FLT3LG on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLT3LG MaxPab mouse polyclonal antibody (B01) now

Add to cart