Brand: | Abnova |
Reference: | H00002322-M06 |
Product name: | FLT3 monoclonal antibody (M06), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLT3. |
Clone: | 3H1 |
Isotype: | IgG2a Kappa |
Gene id: | 2322 |
Gene name: | FLT3 |
Gene alias: | CD135|FLK2|STK1 |
Gene description: | fms-related tyrosine kinase 3 |
Genbank accession: | NM_004119 |
Immunogen: | FLT3 (NP_004110, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP |
Protein accession: | NP_004110 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |