Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLNC polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about FLNC polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002318-A01 |
| Product name: | FLNC polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FLNC. |
| Gene id: | 2318 |
| Gene name: | FLNC |
| Gene alias: | ABP-280|ABP280A|ABPA|ABPL|FLJ10186|FLN2 |
| Gene description: | filamin C, gamma (actin binding protein 280) |
| Genbank accession: | NM_001458 |
| Immunogen: | FLNC (NP_001449.3, 2606 a.a. ~ 2705 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP |
| Protein accession: | NP_001449.3 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | FLNC polyclonal antibody (A01), Lot # FAK0070504QCS1 Western Blot analysis of FLNC expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The cochaperone BAG3 coordinates protein synthesis and autophagy under mechanical strain through spatial regulation of mTORC1.Kathage B, Gehlert S, Ulbricht A, Ludecke L, Tapia VE, Orfanos Z, Wenzel D, Bloch W, Volkmer R, Fleischmann BK, Furst DO, Hohfeld J. Biochim Biophys Acta. 2016 Oct 15;1864(1):62-75. |