FOXO3A monoclonal antibody (M10), clone 4E8 View larger

FOXO3A monoclonal antibody (M10), clone 4E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXO3A monoclonal antibody (M10), clone 4E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about FOXO3A monoclonal antibody (M10), clone 4E8

Brand: Abnova
Reference: H00002309-M10
Product name: FOXO3A monoclonal antibody (M10), clone 4E8
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXO3A.
Clone: 4E8
Isotype: IgG2a Kappa
Gene id: 2309
Gene name: FOXO3
Gene alias: AF6q21|DKFZp781A0677|FKHRL1|FKHRL1P2|FOXO2|FOXO3A|MGC12739|MGC31925
Gene description: forkhead box O3
Genbank accession: BC021224
Immunogen: FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
Protein accession: AAH21224
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002309-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002309-M10-3-31-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXO3A monoclonal antibody (M10), clone 4E8 now

Add to cart