H00002309-M08_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002309-M08 |
Product name: | FOXO3A monoclonal antibody (M08), clone 4F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXO3A. |
Clone: | 4F2 |
Isotype: | IgG2a Kappa |
Gene id: | 2309 |
Gene name: | FOXO3 |
Gene alias: | AF6q21|DKFZp781A0677|FKHRL1|FKHRL1P2|FOXO2|FOXO3A|MGC12739|MGC31925 |
Gene description: | forkhead box O3 |
Genbank accession: | BC021224 |
Immunogen: | FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS |
Protein accession: | AAH21224 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |