Brand: | Abnova |
Reference: | H00002308-M07 |
Product name: | FOXO1A monoclonal antibody (M07), clone 1F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXO1A. |
Clone: | 1F6 |
Isotype: | IgG2a Kappa |
Gene id: | 2308 |
Gene name: | FOXO1 |
Gene alias: | FKH1|FKHR|FOXO1A |
Gene description: | forkhead box O1 |
Genbank accession: | NM_002015 |
Immunogen: | FOXO1A (NP_002006, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG |
Protein accession: | NP_002006 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FOXO1A is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |