Brand: | Abnova |
Reference: | H00002305-M09 |
Product name: | FOXM1 monoclonal antibody (M09), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FOXM1. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 2305 |
Gene name: | FOXM1 |
Gene alias: | FKHL16|FOXM1B|HFH-11|HFH11|HNF-3|INS-1|MPHOSPH2|MPP-2|MPP2|PIG29|TGT3|TRIDENT |
Gene description: | forkhead box M1 |
Genbank accession: | NM_202002 |
Immunogen: | FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS |
Protein accession: | NP_973731 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | FOXM1 monoclonal antibody (M09), clone 1D3 Western Blot analysis of FOXM1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |