Brand: | Abnova |
Reference: | H00002303-M04 |
Product name: | FOXC2 monoclonal antibody (M04), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FOXC2. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 2303 |
Gene name: | FOXC2 |
Gene alias: | FKHL14|LD|MFH-1|MFH1 |
Gene description: | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
Genbank accession: | NM_005251 |
Immunogen: | FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL |
Protein accession: | NP_005242 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Novel FOXC2 Mutation in Hereditary Distichiasis Impairs DNA-Binding Activity and Transcriptional Activation.Zhang L, He J, Han B, Lu L, Fan J, Zhang H, Ge S, Zhou Y, Jia R, Fan X. International Journal of Biological Sciences. 2016 Aug 6;12(9): 1114-1120. |