FOXC2 monoclonal antibody (M03), clone 4B3 View larger

FOXC2 monoclonal antibody (M03), clone 4B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXC2 monoclonal antibody (M03), clone 4B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FOXC2 monoclonal antibody (M03), clone 4B3

Brand: Abnova
Reference: H00002303-M03
Product name: FOXC2 monoclonal antibody (M03), clone 4B3
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXC2.
Clone: 4B3
Isotype: IgG2a Kappa
Gene id: 2303
Gene name: FOXC2
Gene alias: FKHL14|LD|MFH-1|MFH1
Gene description: forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Genbank accession: NM_005251
Immunogen: FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Protein accession: NP_005242.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002303-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002303-M03-1-34-1.jpg
Application image note: FOXC2 monoclonal antibody (M03), clone 4B3 Western Blot analysis of FOXC2 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXC2 monoclonal antibody (M03), clone 4B3 now

Add to cart