Brand: | Abnova |
Reference: | H00002303-M02 |
Product name: | FOXC2 monoclonal antibody (M02), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXC2. |
Clone: | 2H3 |
Isotype: | IgG2b Lambda |
Gene id: | 2303 |
Gene name: | FOXC2 |
Gene alias: | FKHL14|LD|MFH-1|MFH1 |
Gene description: | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
Genbank accession: | NM_005251 |
Immunogen: | FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY |
Protein accession: | NP_005242.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002303-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002303-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002303-M02-3-53-1-L.jpg](http://www.abnova.com/application_image/H00002303-M02-3-53-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | FOXC2 Expression is Associated with Tumor Proliferation and Invasion Potential in Oral Tongue Squamous Cell Carcinoma.Imayama N, Yamada SI, Yanamoto S, Naruse T, Matsushita Y, Takahashi H, Seki S, Fujita S, Ikeda T, Umeda M Pathol Oncol Res. 2015 Jan 9. |