FOXC2 monoclonal antibody (M01A), clone 3H3 View larger

FOXC2 monoclonal antibody (M01A), clone 3H3

H00002303-M01A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXC2 monoclonal antibody (M01A), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about FOXC2 monoclonal antibody (M01A), clone 3H3

Brand: Abnova
Reference: H00002303-M01A
Product name: FOXC2 monoclonal antibody (M01A), clone 3H3
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXC2.
Clone: 3H3
Isotype: IgM Lambda
Gene id: 2303
Gene name: FOXC2
Gene alias: FKHL14|LD|MFH-1|MFH1
Gene description: forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Genbank accession: NM_005251
Immunogen: FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Protein accession: NP_005242.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy FOXC2 monoclonal antibody (M01A), clone 3H3 now

Add to cart