Brand: | Abnova |
Reference: | H00002300-M11 |
Product name: | FOXL1 monoclonal antibody (M11), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FOXL1. |
Clone: | 3D9 |
Isotype: | IgG1 Kappa |
Gene id: | 2300 |
Gene name: | FOXL1 |
Gene alias: | FKH6|FKHL11|FREAC7 |
Gene description: | forkhead box L1 |
Genbank accession: | NM_005250 |
Immunogen: | FOXL1 (NP_005241, 132 a.a. ~ 240 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP |
Protein accession: | NP_005241 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |