FOXL1 monoclonal antibody (M09), clone 2F6 View larger

FOXL1 monoclonal antibody (M09), clone 2F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXL1 monoclonal antibody (M09), clone 2F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,ELISA,WB-Re

More info about FOXL1 monoclonal antibody (M09), clone 2F6

Brand: Abnova
Reference: H00002300-M09
Product name: FOXL1 monoclonal antibody (M09), clone 2F6
Product description: Mouse monoclonal antibody raised against a full length recombinant FOXL1.
Clone: 2F6
Isotype: IgG1 Kappa
Gene id: 2300
Gene name: FOXL1
Gene alias: FKH6|FKHL11|FREAC7
Gene description: forkhead box L1
Genbank accession: NM_005250
Immunogen: FOXL1 (NP_005241, 132 a.a. ~ 240 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
Protein accession: NP_005241
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002300-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002300-M09-3-45-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FOXL1 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXL1 monoclonal antibody (M09), clone 2F6 now

Add to cart