FOXL1 monoclonal antibody (M04), clone 1C3 View larger

FOXL1 monoclonal antibody (M04), clone 1C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXL1 monoclonal antibody (M04), clone 1C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about FOXL1 monoclonal antibody (M04), clone 1C3

Brand: Abnova
Reference: H00002300-M04
Product name: FOXL1 monoclonal antibody (M04), clone 1C3
Product description: Mouse monoclonal antibody raised against a full length recombinant FOXL1.
Clone: 1C3
Isotype: IgG2b Kappa
Gene id: 2300
Gene name: FOXL1
Gene alias: FKH6|FKHL11|FREAC7
Gene description: forkhead box L1
Genbank accession: NM_005250
Immunogen: FOXL1 (NP_005241, 132 a.a. ~ 240 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
Protein accession: NP_005241
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002300-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002300-M04-3-1-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FOXL1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Foxl1 inhibits tumor invasion and predicts outcome in human renal cancer.Yang FQ, Yang FP, Li W, Liu M, Wang GC, Che JP, Huang JH, Zheng JH
Int J Clin Exp Pathol. 2013 Dec 15;7(1):110-22. eCollection 2013.

Reviews

Buy FOXL1 monoclonal antibody (M04), clone 1C3 now

Add to cart