FOXD1 monoclonal antibody (M01), clone 2C10 View larger

FOXD1 monoclonal antibody (M01), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXD1 monoclonal antibody (M01), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about FOXD1 monoclonal antibody (M01), clone 2C10

Brand: Abnova
Reference: H00002297-M01
Product name: FOXD1 monoclonal antibody (M01), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXD1.
Clone: 2C10
Isotype: IgG2b Kappa
Gene id: 2297
Gene name: FOXD1
Gene alias: FKHL8|FREAC4
Gene description: forkhead box D1
Genbank accession: NM_004472
Immunogen: FOXD1 (NP_004463, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPP
Protein accession: NP_004463
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002297-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002297-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged FOXD1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOXD1 monoclonal antibody (M01), clone 2C10 now

Add to cart