Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FOXF2 monoclonal antibody (M04), clone 2G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about FOXF2 monoclonal antibody (M04), clone 2G10
| Brand: | Abnova |
| Reference: | H00002295-M04 |
| Product name: | FOXF2 monoclonal antibody (M04), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXF2. |
| Clone: | 2G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2295 |
| Gene name: | FOXF2 |
| Gene alias: | FKHL6|FREAC2 |
| Gene description: | forkhead box F2 |
| Genbank accession: | NM_001452 |
| Immunogen: | FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV |
| Protein accession: | NP_001443 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MicroRNA-301 Mediates Proliferation and Invasion in Human Breast Cancer.Shi W, Gerster K, Alajez NM, Tsang J, Waldron L, Pintilie M, Hui AB, Sykes J, P'ng C, Miller N, McCready D, Fyles A, Liu FF. Cancer Res. 2011 Apr 15;71(8):2926-2937. Epub 2011 Mar 10. |