Brand: | Abnova |
Reference: | H00002280-M01 |
Product name: | FKBP1A monoclonal antibody (M01), clone 1E5-A12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FKBP1A. |
Clone: | 1E5-A12 |
Isotype: | IgG1 kappa |
Gene id: | 2280 |
Gene name: | FKBP1A |
Gene alias: | FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE |
Gene description: | FK506 binding protein 1A, 12kDa |
Genbank accession: | BC005147 |
Immunogen: | FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Protein accession: | AAH05147 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FKBP1A monoclonal antibody (M01), clone 1E5-A12 Western Blot analysis of FKBP1A expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Protein-protein interactions: an application of tus-ter mediated protein microarray system.Sitaraman K, Chatterjee DK. Methods Mol Biol. 2011;723:185-200. |