FKBP1A monoclonal antibody (M01), clone 1E5-A12 View larger

FKBP1A monoclonal antibody (M01), clone 1E5-A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FKBP1A monoclonal antibody (M01), clone 1E5-A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about FKBP1A monoclonal antibody (M01), clone 1E5-A12

Brand: Abnova
Reference: H00002280-M01
Product name: FKBP1A monoclonal antibody (M01), clone 1E5-A12
Product description: Mouse monoclonal antibody raised against a full length recombinant FKBP1A.
Clone: 1E5-A12
Isotype: IgG1 kappa
Gene id: 2280
Gene name: FKBP1A
Gene alias: FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE
Gene description: FK506 binding protein 1A, 12kDa
Genbank accession: BC005147
Immunogen: FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Protein accession: AAH05147
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002280-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002280-M01-1-2-1.jpg
Application image note: FKBP1A monoclonal antibody (M01), clone 1E5-A12 Western Blot analysis of FKBP1A expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Protein-protein interactions: an application of tus-ter mediated protein microarray system.Sitaraman K, Chatterjee DK.
Methods Mol Biol. 2011;723:185-200.

Reviews

Buy FKBP1A monoclonal antibody (M01), clone 1E5-A12 now

Add to cart