FHIT monoclonal antibody (M06), clone 1B5 View larger

FHIT monoclonal antibody (M06), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FHIT monoclonal antibody (M06), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FHIT monoclonal antibody (M06), clone 1B5

Brand: Abnova
Reference: H00002272-M06
Product name: FHIT monoclonal antibody (M06), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant FHIT.
Clone: 1B5
Isotype: IgG1 kappa
Gene id: 2272
Gene name: FHIT
Gene alias: AP3Aase|FRA3B
Gene description: fragile histidine triad gene
Genbank accession: BC032336
Immunogen: FHIT (AAH32336, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
Protein accession: AAH32336
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002272-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002272-M06-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged FHIT is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FHIT monoclonal antibody (M06), clone 1B5 now

Add to cart