Brand: | Abnova |
Reference: | H00002272-M05 |
Product name: | FHIT monoclonal antibody (M05), clone 2G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FHIT. |
Clone: | 2G3 |
Isotype: | IgG1 Kappa |
Gene id: | 2272 |
Gene name: | FHIT |
Gene alias: | AP3Aase|FRA3B |
Gene description: | fragile histidine triad gene |
Genbank accession: | BC032336 |
Immunogen: | FHIT (AAH32336, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR |
Protein accession: | AAH32336 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002272-M05-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002272-M05-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged FHIT is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |