Brand: | Abnova |
Reference: | H00002268-M02 |
Product name: | FGR monoclonal antibody (M02), clone 3B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGR. |
Clone: | 3B11 |
Isotype: | IgG2a Kappa |
Gene id: | 2268 |
Gene name: | FGR |
Gene alias: | FLJ43153|MGC75096|SRC2|c-fgr|c-src2|p55c-fgr|p58c-fgr |
Gene description: | Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog |
Genbank accession: | BC064382 |
Immunogen: | FGR (AAH64382, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA |
Protein accession: | AAH64382 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002268-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002268-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00002268-M02-3-10-1-L.jpg](http://www.abnova.com/application_image/H00002268-M02-3-10-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |