Brand: | Abnova |
Reference: | H00002266-M01 |
Product name: | FGG monoclonal antibody (M01), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGG. |
Clone: | 1F2 |
Isotype: | IgG1 kappa |
Gene id: | 2266 |
Gene name: | FGG |
Gene alias: | - |
Gene description: | fibrinogen gamma chain |
Genbank accession: | BC007044 |
Immunogen: | FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD |
Protein accession: | AAH07044 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics.Horlock C, Shakib F, Mahdavi J, Jones NS, Sewell HF, Ghaemmaghami AM. Genome Biol. 2007;8(3):R30. |