Brand: | Abnova |
Reference: | H00002263-M02 |
Product name: | FGFR2 monoclonal antibody (M02), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGFR2. |
Clone: | 2E8 |
Isotype: | IgG2b Kappa |
Gene id: | 2263 |
Gene name: | FGFR2 |
Gene alias: | BEK|BFR-1|CD332|CEK3|CFD1|ECT1|FLJ98662|JWS|K-SAM|KGFR|TK14|TK25 |
Gene description: | fibroblast growth factor receptor 2 |
Genbank accession: | BC039243 |
Immunogen: | FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT |
Protein accession: | AAH39243 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |