FGFR1 monoclonal antibody (M08), clone 1E4 View larger

FGFR1 monoclonal antibody (M08), clone 1E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGFR1 monoclonal antibody (M08), clone 1E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FGFR1 monoclonal antibody (M08), clone 1E4

Brand: Abnova
Reference: H00002260-M08
Product name: FGFR1 monoclonal antibody (M08), clone 1E4
Product description: Mouse monoclonal antibody raised against a partial recombinant FGFR1.
Clone: 1E4
Isotype: IgG2b Kappa
Gene id: 2260
Gene name: FGFR1
Gene alias: BFGFR|CD331|CEK|FGFBR|FLG|FLJ99988|FLT2|HBGFR|KAL2|N-SAM
Gene description: fibroblast growth factor receptor 1
Genbank accession: NM_000604
Immunogen: FGFR1 (NP_000595.1, 303 a.a. ~ 408 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDF
Protein accession: NP_000595.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002260-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002260-M08-1-18-1.jpg
Application image note: FGFR1 monoclonal antibody (M08), clone 1E4 Western Blot analysis of FGFR1 expression in COLO 320 HSR ( Cat # L020V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FGFR1 monoclonal antibody (M08), clone 1E4 now

Add to cart