Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF5 monoclonal antibody (M01), clone 1B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,IP,PLA-Ce |
More info about FGF5 monoclonal antibody (M01), clone 1B4
| Brand: | Abnova |
| Reference: | H00002250-M01 |
| Product name: | FGF5 monoclonal antibody (M01), clone 1B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FGF5. |
| Clone: | 1B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2250 |
| Gene name: | FGF5 |
| Gene alias: | HBGF-5|Smag-82 |
| Gene description: | fibroblast growth factor 5 |
| Genbank accession: | NM_004464 |
| Immunogen: | FGF5 (NP_004455.2, 159 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
| Protein accession: | NP_004455.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF5. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | WB-Ti,S-ELISA,ELISA,IP,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Evidence of post-transcriptional readthrough regulation in FGF5 gene of alpaca.Pallotti S, Pediconi D, Subramanian D, Molina MG, Antonini M, Morelli MB, Renieri C, La Terza A. Gene. 2018 Mar 20;647:121-128. doi: 10.1016/j.gene.2018.01.006. Epub 2018 Jan 5. |