Brand: | Abnova |
Reference: | H00002246-M01 |
Product name: | FGF1 monoclonal antibody (M01), clone 3F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGF1. |
Clone: | 3F5 |
Isotype: | IgG1 Kappa |
Gene id: | 2246 |
Gene name: | FGF1 |
Gene alias: | AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1 |
Gene description: | fibroblast growth factor 1 (acidic) |
Genbank accession: | BC032697 |
Immunogen: | FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Protein accession: | AAH32697 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged FGF1 is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Acidic Fibroblast Growth Factor (FGF) Potentiates Glial-mediated Neurotoxicity by Activating FGFR2 IIIb Protein.Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer PL. J Biol Chem. 2011 Dec 2;286(48):41230-45. Epub 2011 Oct 11. |