Brand: | Abnova |
Reference: | H00002244-M01 |
Product name: | FGB monoclonal antibody (M01), clone 1D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGB. |
Clone: | 1D7 |
Isotype: | IgG2a Kappa |
Gene id: | 2244 |
Gene name: | FGB |
Gene alias: | MGC104327|MGC120405 |
Gene description: | fibrinogen beta chain |
Genbank accession: | NM_005141 |
Immunogen: | FGB (NP_005132, 392 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ |
Protein accession: | NP_005132 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002244-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002244-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![H00002244-M01-1-12-1.jpg](http://www.abnova.com/application_image/H00002244-M01-1-12-1.jpg) |
Application image note: | FGB monoclonal antibody (M01), clone 1D7. Western Blot analysis of FGB expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |