FDPS monoclonal antibody (M01), clone 3A6 View larger

FDPS monoclonal antibody (M01), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FDPS monoclonal antibody (M01), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FDPS monoclonal antibody (M01), clone 3A6

Brand: Abnova
Reference: H00002224-M01
Product name: FDPS monoclonal antibody (M01), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant FDPS.
Clone: 3A6
Isotype: IgG2a Kappa
Gene id: 2224
Gene name: FDPS
Gene alias: FPPS|FPS
Gene description: farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase)
Genbank accession: NM_002004
Immunogen: FDPS (NP_001995.1, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Protein accession: NP_001995.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002224-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged FDPS is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FDPS monoclonal antibody (M01), clone 3A6 now

Add to cart