FCN2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002220-D01P
Product name: FCN2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FCN2 protein.
Gene id: 2220
Gene name: FCN2
Gene alias: EBP-37|FCNL|P35|ficolin-2
Gene description: ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
Genbank accession: BC069825
Immunogen: FCN2 (NP_004099.2, 1 a.a. ~ 313 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Protein accession: NP_004099.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002220-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FCN2 expression in transfected 293T cell line (H00002220-T02) by FCN2 MaxPab polyclonal antibody.

Lane 1: FCN2 transfected lysate(34.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FCN2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart