Brand: | Abnova |
Reference: | H00002218-A01 |
Product name: | FCMD polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FCMD. |
Gene id: | 2218 |
Gene name: | FKTN |
Gene alias: | CMD1X|FCMD|LGMD2M|MGC126857|MGC134944|MGC134945|MGC138243 |
Gene description: | fukutin |
Genbank accession: | NM_006731 |
Immunogen: | FCMD (NP_006722, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCL |
Protein accession: | NP_006722 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FCMD polyclonal antibody (A01), Lot # 051102JC01. Western Blot analysis of FCMD expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |