FCGR3A monoclonal antibody (M03), clone 2B11 View larger

FCGR3A monoclonal antibody (M03), clone 2B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FCGR3A monoclonal antibody (M03), clone 2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FCGR3A monoclonal antibody (M03), clone 2B11

Brand: Abnova
Reference: H00002214-M03
Product name: FCGR3A monoclonal antibody (M03), clone 2B11
Product description: Mouse monoclonal antibody raised against a full-length recombinant FCGR3A.
Clone: 2B11
Isotype: IgG2a Kappa
Gene id: 2214
Gene name: FCGR3A
Gene alias: CD16|CD16A|FCG3|FCGR3|FCGRIII|FCR-10|FCRIII|FCRIIIA|IGFR3
Gene description: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
Genbank accession: BC017865
Immunogen: FCGR3A (AAH17865.1, 17 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK
Protein accession: AAH17865.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002214-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.92 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002214-M03-1-6-1.jpg
Application image note: FCGR3A monoclonal antibody (M03), clone 2B11. Western Blot analysis of FCGR3A expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FCGR3A monoclonal antibody (M03), clone 2B11 now

Add to cart