Brand: | Abnova |
Reference: | H00002213-M01A |
Product name: | FCGR2B monoclonal antibody (M01A), clone 2E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FCGR2B. |
Clone: | 2E10 |
Isotype: | IgG1 Kappa |
Gene id: | 2213 |
Gene name: | FCGR2B |
Gene alias: | CD32|CD32B|FCG2|FCGR2|IGFR2 |
Gene description: | Fc fragment of IgG, low affinity IIb, receptor (CD32) |
Genbank accession: | BC031992 |
Immunogen: | FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS |
Protein accession: | AAH31992 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FCGR2B monoclonal antibody (M01A), clone 2E10 Western Blot analysis of FCGR2B expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |